PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g46247.1.p
Common NameBRADI_1g46247, LOC100830297
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family HD-ZIP
Protein Properties Length: 786aa    MW: 84887.2 Da    PI: 5.7356
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g46247.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.29.3e-2193148156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       r++ +++t+ q+++Le +F+++++p++++r++L+++lgL+ rq+k+WFqNrR+++k
  Bradi1g46247.1.p  93 RKRYHRHTPRQIQTLEGMFKECPHPDENQRAQLSRELGLEARQIKFWFQNRRTQMK 148
                       789999***********************************************998 PP

2START135.84.8e-432995242205
                       HHHHHHHHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS...........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.. CS
             START   2 laeeaaqelvkkalaeepgWvkss.....esengdevlqkfeeskv..........dsgealrasgvvdmvlallveellddkeqWdetla.. 77 
                       +a +a++e++++a a+e +W k++     e +n d++ + f +              ++e  r +++v+m +a lve ++d++ +W e ++  
  Bradi1g46247.1.p 299 IAARAMDEVIRLANAGEHVWIKVPggdgyETLNVDTYDSLFGK--PgssssfragdVRVEGTRHCAHVFMSAAPLVEVFMDTN-KWMEFFPsi 388
                       6789********************9999966666666555533..233667999999**************************.*******99 PP

                       ..EEEEEEEECTT.....EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEE CS
             START  78 ..kaetlevissg.....galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghs 162
                          a t++ + +g     + l lm+ e+ +l+plv  R+f f+Ry+rq  +g w+i+dvSv+ e++ +      R+++lpSg+li +++ng+s
  Bradi1g46247.1.p 389 vaNARTVDNLVNGldgrsESLILMYEEMHMLTPLVQsREFSFLRYCRQIDQGLWAIADVSVETERDAQ-FGVPSRSRRLPSGCLIADMANGYS 480
                       99****************************************************************98.45557999**************** PP

                       EEEEEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
             START 163 kvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqce 205
                       kvtwveh++ +++ p   l+r +v sg+ +ga++w+ +l + c 
  Bradi1g46247.1.p 481 KVTWVEHMEIEDKGPiGVLYRDMVTSGAGFGAQRWLGALSNACD 524
                       ***************99**********************99996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.6E-2077150IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-2182152IPR009057Homeodomain-like
PROSITE profilePS5007117.70290150IPR001356Homeobox domain
SMARTSM003896.2E-1991154IPR001356Homeobox domain
CDDcd000861.73E-1892151No hitNo description
PfamPF000462.3E-1893148IPR001356Homeobox domain
PROSITE patternPS000270125148IPR017970Homeobox, conserved site
PROSITE profilePS5084843.863289528IPR002913START domain
SuperFamilySSF559611.02E-29290527No hitNo description
CDDcd088754.48E-91293523No hitNo description
SMARTSM002342.2E-24298525IPR002913START domain
PfamPF018525.2E-36299524IPR002913START domain
Gene3DG3DSA:3.30.530.201.6E-5364494IPR023393START-like domain
SuperFamilySSF559612.04E-16547769No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 786 aa     Download sequence    Send to blast
MDGWPDQQKE PGISQDISAS ASLISSCALL LSWCINRSTG QARVLTQHST TQHSNLSSPS  60
SFPQRARAPT AMDFGDDFPE GSDSHGQQQN NRRKRYHRHT PRQIQTLEGM FKECPHPDEN  120
QRAQLSRELG LEARQIKFWF QNRRTQMKAQ HERADNCFLR AENDKIRCEN IAMGEALKNV  180
ICPTCGGPPV GEDFFDEQKL RMENARLKEE LDRVSSVASK FLGRPYSMSQ MPHGTPPLSV  240
NSLDLSMGSL GMGGQPLGVG GLGGGPTPQD LELLGSSEIP QFQMPAPVSE MERPVMAGIA  300
ARAMDEVIRL ANAGEHVWIK VPGGDGYETL NVDTYDSLFG KPGSSSSFRA GDVRVEGTRH  360
CAHVFMSAAP LVEVFMDTNK WMEFFPSIVA NARTVDNLVN GLDGRSESLI LMYEEMHMLT  420
PLVQSREFSF LRYCRQIDQG LWAIADVSVE TERDAQFGVP SRSRRLPSGC LIADMANGYS  480
KVTWVEHMEI EDKGPIGVLY RDMVTSGAGF GAQRWLGALS NACDRYGALA ALAVMNAADL  540
GAVTADGRRS MMKLSQRMVA NFCGALTANQ LIVWTTIPGG ANDMNVRVSL HRVDEPGLPN  600
GVVLSAATSV WLPVPCDHVF VFLRDVNTRN QWDVLTHGNT VQEACRIPNG SDPANCVTLL  660
RGVNASHDSM LVLQESCADP SGSMLVYSPI DMPAVNLVTS GEDTANIPLL PSGFIILPDG  720
RNSVSAGGGA GSSGGGVLAG CVVTVAFQIL ISSLPACKVN SESIATVGGL INTTIANLKT  780
ALNCG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1016511e-133AB101651.1 Oryza sativa Japonica Group Roc8 mRNA for GL2-type homeodomain protein, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564122.20.0PREDICTED: homeobox-leucine zipper protein ROC8-like
SwissprotQ69T580.0ROC8_ORYSJ; Homeobox-leucine zipper protein ROC8
TrEMBLA0A0Q3JMV00.0A0A0Q3JMV0_BRADI; Uncharacterized protein
STRINGBRADI1G46247.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29123770
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11